Published on

小刚

sizzling hot free game online-🎖️m sloth levine|XOXE88.COM

m sloth levine

DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusizzling hot free game onlinesnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.

Pemerintahmenyiapkan8kebijakandalampenyelesaianmasalahhonorer.Daripoin1hingga8menguntungkanpegawainon-ASN.IlustrasiASN:Ricardo/JPNN.comjpnn.com,JAKARTA-Pemerintahmulaimelakukanlangkah-langkahpenyelesaianmasalahpegawainon-aparatursipilnegara(ASN).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DimulaidariterbitnyaSEMenPAN-RBtentangstatuskepegawaiandiinstansipemerintahpusatdandaerah.SalahsatupoinmendasardalamSEyangditandanganiMenPAN-RBTjahjoKumolopada31Mei2022ituadalahhonorerditiadakanpada28November2023,danyangadahanyalahPNSdanPPPK.BacaJuga:MahfudMD:IngatBatasWaktuPendataanHonorer,TerlambatAdaKonsekuensinya Duabulanberselang,terbitlagiSEMenPAN-RBtentangpendataantenagaNon-ASNyangditandatanganiMahfudMDsebagaipelaksanatugaspada22Juli.Rentetankebijakantersebut,sebenarnyasudahdisampaikanPltMenPAN-RBMahfudMDdalamrapatkoordinasipembahasanpenyelesaiantenaganon-ASNdilingkunganinstansipemerintahpada24Juni.Dalamrakoryangdihadiriperwakilandarisekdaprovinsi,AsosiasiPemerintahKabupatenSeluruhIndonesia(APKASI),danAsosiasiPemerintahKotaSeluruhIndonesia(APEKSI)itu,MahfudMDmenyampaikanarahkebijakanpemerintahdalammenuntaskanmasalahtenaganon-ASN,yaitu:BacaJuga:6DokumenIniHarusDisiapkanuntukPendataanHonorer,SeluruhPegawaiNon-ASNPerluTahu 1.Pemetaanhonoreratautenaganon-ASNSaatini,pemerintahpusatdandaerahharusfokusmengaturstrategimenatapegawaidiinstansipemerintahuntukpercepatantransformasisumberdayamanusiatanpamenghilangkansisikemanusiaandanmeritokrasinya.Olehkarenanya,Mahfudmemintaparapejabatpembinakepegawaian(PPK)melakukanpemetaanhonoreruntukmelihatjumlahyangreal.FutriZulyaSavitrisaatmendampingisangayah,ZulkifliHasanyangdilantikPresidenJokowimenjadiMenteriPerdaganganRIdiIstanaNegara,Jakarta,Rabu(15/6).Foto:DPPPANjpnn.com,JAKARTA-MantanistriAhmadMumtazRais,FutriZulyaSavitriresmibergantinamasecaranegaramenjadiPutriZulkifliHasan.HalinidiketahuisetelahPutrimendapatkansorotanpublikkarenaperceraiannyadenganputraAmienRaistersebut.AnakdaripolitikusZulkifliHasanitumengajukanpermohonangantinamakePengadilanNegeri(PN)JakartaSelatan.BacaJuga:TerbaringLemas,SuleMintaNetizenBerhentiMenghujatPutriDelinaBerdasarkanyangtercatatdalamSistemInformasiPenelusuranPerkara(SIPP)PNJakartaSelatan,Putrimengajukanpermohonanpada6Juni2022.Permohonantersebutlantasdikabulkanolehmajelishakimpada28Juni2022.SebagaimanadalamkutipanAkteKelahiran,(FutriZulyaSavitri)menggantinamamenjadiPutriZulkifliHasan,begitutertulisketeranganyangtercatatdiSIPPdengannomorperkara430/Pdt.P/2022/PNJKT.SEL.BacaJuga:JamakSalatKarenaSibukBekerja,BagaimanaHukumnya?Putrimelaluitigapersidangansebelumakhirnyamajelishakimmengeluarkanpenetapan.Meskitelahberganti,berbagaidokumenyangtelahtercatatdengannamaFutriZulyaSavitrimasihtetapberlakudimatanegara.sizzling hot free game online

sizzling hot free game online-🎖️m sloth levine|XOXE88.COM

KomisionerKomnasHAMMohammadChoirulAnambicarapenundaanpemeriksaanujibalistik.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)menundapemeriksaanhasilujibalistikolehPolriterkaitsenjataapi(senpi)yangdipakaidalambakutembakdirumahKadivPropamnonaktifPolriIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomnasHAMsedianyamemintaketeranganujibalistikdariPolripadaRabu(3/8),ditundamenjadiJumat(5/8).PenundaanjadwalitudisampaikanKomisionerKomnasHAMChoirulAnamdalamketerangantertulisyangditerimadiJakarta,Selasa(2/8).BacaJuga:HasilUjiBalistik,BharadaEPakaiGlock17,BrigadirJPistolHS9,SudutTembakan?Perubahan(jadwal)inidisampaikanolehKetuaTimKhususPolri,kataAnam.Diketahui,dalambakutembakdirumahFerdySambo,BrigadirJmemakaipistolHS9,sedangkanBharadaEmenggunakanGlock17.DiajugamenjelaskanalasanTimKhusus(Timsus)yangsebelumnyadibentukolehKapolriJenderalListyoSigitPrabowomemintapenundaanjadwalpermintaanketeranganolehKomnasHAM.BacaJuga:KematianBrigadirJSudah25Hari,AlArafSinggungsoalSenjataApiKarenamasihmembutuhkanwaktuuntukpersiapanbahanyangdiperlukanolehKomnasHAM,ucappriayangpernahaktifdiYLBHIitu.Anammengatakanperubahanjadwalitubisamemaksimalkanprosespemberianketerangan,sekaliguspendalamandatadanfaktadalammengungkapkasuskematianBrigadirYosuaHutabarataliasBrigadirJ.MenteriKomunikasidanInformatikaJohnnyG.Plate.Ilustrasi:Dok.Kominfojpnn.com,JAKARTA-KementerianKomunikasidanInformatika(Kemenkominfo)akhirnyamemblokir15sistemelektronik(PSE)gameonlineyangmengandungunsurperjudian.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HaltersebutdiungkapkanlangsungolehMenteriKomunikasidanInformatikaJohnnyG.Platedalampernyataanresmi,Selasa(2/8).Kamitelahmelakukanpemutusanaksesterhadap15SistemElektronikyangmengandungunsurperjudianpadahariSelasa,2Agustus2022,kataMenteriJohnnydalamsiaranpersnya,Selasa.BacaJuga:NekatMenggelapkanMotorMertua,RRPakaiBuatJudiOnline,SontoloyoAdapun15gamejudionlineitudiantaranyaDominoQiuQiu,Topfun,PopDomino,MVPDomino,PopPoker,LetsDominoGapleQiuQiuPokerGameOnline,SteveDominoQiuQiuPokerSlotsGameOnline,HiggsSlotDominoGapleQiuQiu,LudoDream,DominoQiuQiu99BoyaaQQKIU,DominoGapleBoyaQiuQiuCapsa,PokerTexasBoyaa,PokerPro.id,PopBig2,danPopGaple.MenurutJohnny,PSEyangmelakukankegiatanjudionlinemelanggarperaturanUndang-UndangNomor11tahun2008tentangInformasidanTransaksiElektronikPasal27ayat(2),danPasal96huruf(a)PeraturanPemerintahNomor71tahun2019tentangPenyelenggaraanSistemdanTransaksiElektronik.JohnnymengatakanKemenkominfomemilikikomitmenkuatterhadappemberantasanjudionline,sehinggaakanteruskonsistenmelakukanpemutusanaksesterhadapkontenyangmemuatunsurperjudian.BacaJuga:Kemenkominfo-SiberKreasiGelarPelatihanLiterasiDigitaluntukMasyarakatdiKotaIniKamitelahmemblokirsebanyak534.183kontenjudiyangditemukandalamsitusinternetsejaktahun2018,ujarJohnny.Inimenunjukkankomitmenkuatkamiterhadappemberantasanjudionline,sambungnya.KadivHumasPolriIrjenDediPrasetyosaattibadilokasibakutembakyangmenewaskanBrigadirNofryansahYosuaHutabaratatauBrigadirJdiKomplekPolri,DurenTiga,JakartaSelatan,Senin(1/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-DosenFakultasHukumUniversitasBrawijaya(Unibraw)AlArafmenyorotikematianBrigadirYosuaaliasBrigadirJsetelah25hariberlalu,tetapipengusutannyabelumjugatuntas.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutAlAraf,sejumlahlangkahsudahditempuhPolridalammengusutbakutembakdirumahKadivPropamnonaktifPolriIrjenFerdySamboyangmenewaskanBrigadirJ,Jumat(8/7)lalu.LangkahtersebutdarimembentuktimkhusushinggapencopotanjabatansejumlahperwiratinggidanmenengahPolrigunamengevaluasipenanganankasusitu.BacaJuga:TernyataPriaInijugaTahuIstriFerdySamboBegituPengungkapankasuskematianBrigadirJinihanyabisadilakukanjikaprosesinvestigasinyadilakukansecaratransparan,akuntabel,danberdasarkanprinsip-prinsipnegarahukum,ucapAlArafdalamketerangandiJakarta,Selasa(2/8).DiamenerangkansalahsatuprinsiputamadalamnegarahukumadalahpengakuanatasprinsippersamaandihadapanhukumsesuaiamanatPasal27Ayat(1)UUD.Prinsipitumenyiratkanmaknabahwaseluruhwarganegaraharusdiperlakukansamadimukahukum,tegaspriayangjugapegiatdiKoalisiReformasiSektorKeamanan.BacaJuga:KomnasHAMMelihatBuktiPentingIni,AdaFerdySambo&BrigadirYosua,JelasSudahMenurutAlArafdalamkonstruksinegarahukumitu,makaprosespengungkapankasuskematianBrigadirJharusmenghormatidueprocessoflaw.Berdasarkanprinsipini,setiappihakyangterlibatharusdihormatihak-haknyabaiksebagaisaksimaupunsebagaitersangka.sizzling hot free game onlineKuasahukumkeluargaBrigadirJ,KamaruddinSimanjuntak.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KasusdugaanpelecehanseksualterhadapistriIrjenFerdySambo,PutriCandrawathikiniditanganiBareskrimPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KasusitusempatditanganipenyidikDirektoratReserseKriminalUmum(Ditreskrimum)PoldaMetroJayasetelahdilimpahkandariPolresJakartaSelatan.Kasusitujugatelahnaikpenyidikan.BacaJuga:KabarTerbaruKasusBrigadirJ,RickySaksiPenting,TahuIstriFerdySamboDilecehkan?AdapunterlapordalamkasusituialahBrigadirNofryansahYosuaHutabaratatauBrigadirJ,korbanpenembakanBharadaEdirumahdinasnonaktifKadivPropamPolriIrjenFerdySambo,KomplekPolri,DurenTiga,JakartaSelatanpadaJumat(8/7).Meresponskasusitu,kuasahukumkeluargaBrigadirJ,KamaruddinSimanjuntakoptimisitiskasusitutakbisadilanjutkan.Sebab,terlapordalamkasusitutelahmeninggaldunia.BacaJuga:KabarTerbaruSoalIstriFerdySambo,WakilKetuaLPSK:IbuPutriLebihNyamanKalau...(Kasusdugaanpelecehanseksual,red)Tidakakanjalan,karenaorangmatitidakbisadimintaipertanggungjawaban,kataKamaruddindiBareskrimPolri,Selasa(2/8).BrigadirJdisebuttewasseusaiterlibatbakutembakdenganBharadaEdirumahdinasIrjenFerdySambo,DurenTiga,Pancoran,JakartaSelatan,Jumat(8/7).KuasahukumkeluargaBrigadirJ,KamaruddinSimanjuntaksaatmemberiketerangandiBareskrimPolri,Selasa(2/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-KamaruddinSimanjuntakmenyakinikematianBrigadirNofryansahYosuaHutabaratbukankarenabakutembak,tetapidugaanpembunuhanberencana.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Diketahui,perihaldugaanpembunuhanberencanaitutelahdilaporkanpihakkeluarga.Kini,kasusyangditanganiBareskrimPolriitutelahnaikpenyidikan.BacaJuga:KasusBrigadirJ,TimsusPolriMintaPemeriksaanUjiBalistikDitunda,AlasannyaVersiMabesPolri,BrigadirJtewassetelahterlibatbakutembakdenganBharadaEdirumahdinasnonaktifKadivPropamPolriIrjenFerdySambopadaJumat(8/7).Kalausayamengatakanbukanbakutembak,tetapipembunuhanterencana,katakuasahukumkeluargaBrigadirJitudiBareskrimPolri,Selasa(2/8).KamaruddinpunmembeberkanalasanbahwaBrigadirJtewaskarenadugaanpembunuhanberencana.BacaJuga:TanyakanKeberadaanHP&PakaianBrigadirJkePenyidik,Kamaruddin:MerekaTakBeraniMenjawabSalahsatunya,tembakandaribelakangkepalatembuskehidungberdasarhasilsementaraautopsiulangyangdigelardiJambipadaRabu(27/7).Contohadatembakdibelakangkepala.(Diduga,red,lsetelahdia(BrigadirJ,red)terkelungkuptembaklagiuntukmemastikansupayamati,berartiterencanapembunuhanitu,ujardia.

Ilustrasi-PasangansuamiistriFoto:Ricardo/JPNN.comjpnn.com-InfeksisalurankemihatauISKdapatdialamiolehsiapasaja,terutamawanita.Secaraumum,gejalanyaberupanyeriataupanasketikasedangbuangairkecil,nyeripadapanggul,danwarnaurineterlihatkeruh.Penyebabdariinfeksisalurankemihadalahinfeksibakteriyangmasukmelaluisalurankencing.BacaJuga:JamakSalatKarenaSibukBekerja,BagaimanaHukumnya?Kondisiinilebihseringmenyerangwanita,karenauretrapadatubuhperempuanlebihpendekketimbangpria.Selainitu,posisivaginaberadadekatdengankandungkemih.Halinimembuatbakterilebihmudahmasukdanmenginfeksi.Keluhaninitidakhanyamengganggukenyamanansaatbuangairkecilsaja,tetapijugabisamenghancurkannikmatnyahubunganintim.Lalu,bolehkahberhubunganintimsaatinfeksisalurankemih?BacaJuga:FaktaUnikSeputarSeks,WowBolehkahPenderitaInfeksiSaluranKemihBerhubunganIntim?Penderitainfeksisalurankemihumumnyadisarankanmenundaberhubunganseks,karenabisamemperburukkondisiyangdialami.KuasahukumkeluargaBrigadirNofryansahYosuahHutabarat,KamaruddinSimanjuntaksaatmemberikanpernyataanseusaimenjalanipemeriksaansebagaisaksipelapordiBareskrimPolri,Selasa(2/8)malam.Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-PengacarakeluargaBrigadirYosuaHutabarataliasBrigadirJbertemudengantimkuasahukumistriIrjenFerdySambodiruangpemeriksaanDirektoratTindakPidanaUmumBareskrimPolri,Jakarta.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HaltakterdugaituterjadisaatkeduabelahpihakdatangkeGedungBareskrimuntukurusanyangberbeda,Selasa(2/8).PertemuanterjadiantaratimpengacarakeluargaBrigadirJ,KamarudinSimanjuntakCsdengantigakuasahukumPutriFerdySambo,yakniArmanHanis,PatraMZain,danSarmualiSimangunsong.BacaJuga:KasusBrigadirJ,TimsusPolriMintaPemeriksaanUjiBalistikDitunda,AlasannyaKeduapihakitusebenarnyadatangkebertemupenyidikBareskrimuntukurusanmasing-masing.PengacarakeluargaBrigadirJdatangmemenuhipanggilanpenyidikuntukmelengkapiBeritaAcaraPemeriksaan(BAP)sebagaisaksipelaporkasusdugaanpembunuhanberencana,peretasan,danpencurianponselBrigadirYosua.SementaratimkuasahukumPutriCandrawathisangistriFerdySambodatangmenyerahkansuratterkaitlaporanyangdilayangkankliennyatentangdugaanpelecehandanpengancamanpembunuhan.BacaJuga:KematianBrigadirJSudah25Hari,AlArafSinggungsoalSenjataApiHariinikamimengirimkansuratkePakDirtipidumterkaitlaporanklienkamiuntukditindaklanjuti,kataArman.Armanmengklaimberdasarkaninformasiyangmerekaterima,dirtipidumsudahmenanganilaporanterkaitpencabulanmaupunpengancamandariPutriFerdySambo.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.

RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.

IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.

sizzling hot free game online-🎖️m sloth levine|XOXE88.COM

MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenteriKoordinatorBidangPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDinginagarBhayangkaraDuaRichardEliezeratauBharadaEmendapatperlindungan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudmendorongPolriagarmemfasilitasiLembagaPerlindunganSaksidanKorban(LPSK)untukmemberikanperlindungankepadaBharadaE.Melaluimimbarini,sayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberikanperlindungankepadaBharadaE,agardiaselamatdaripenganiayaanatauapapun,sehinggapendampingandariLPSKitudiaturdengansedemikianrupaagarnantiBharadaEbisasampaikepengadilandanmemberikanketerangandipengadilan,kataMahfuddalamkonferensiperssebagaimanadipantaumelaluikanalYouTubeKemenkoPolhukamdiJakarta,Selasa.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanMahfudmengapresiasipengacaraBharadaE,yakniDeolipaYumarayangmengomunikasikansecarabaikmengenaihal-halyangsebenarnyadialamiolehkliennya.Sebelumnya,Rabu(3/8),PolritelahmenetapkanBharadaEsebagaitersangkadalamkasuskematianBrigadirYoshuaHutabaratatauBrigadirJ.Sampaihariini,selainBharadaE,Polrijugatelahmenetapkanbeberapatersangkalainnya,yaituBripkaRR,KM,danmantanKadivPropamPolriIrjenFerdySambo.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuKeempatnyadisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.Dalamkesempatanyangsama,MahfudpunmengatakansegeramenyampaikankepadaPolriagarkeluargaBrigadirJdiberikanperlindungansecaraprofesional.

Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.

PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitralandHotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).

sizzling hot free game online-🎖️m sloth levine|XOXE88.COM

Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.

GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaik 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.IstriIrjenFerdySambo,PutriCandrawathi.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTASELATAN-PutriCandrawathi,istriIrjenFerdySamboturutmenyaksikansaatpenyidiktimkhusus(timsus)PolrimenggeledahrumahpribadinyadiRT07RW02JalanSaguling,KompleksPertambangan,DurenTiga,Pancoran,JakartaSelatan(Jaksel),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ketuarukuntanggasetempat,YosefmengatakanPutrihanyamenangisketikapenyidikmenggeledah.Iya,diamenangisterusdikamar,susahkamiberkomunikasi,kataYosefdikutipdariAntara,Rabu(10/8).BacaJuga:KPKBelumBisaUmumkanHartaKekayaanIrjenFerdySambo,AdaApa?YosefmengatakandirinyadimintaikuthadirdalamprosespenggeledahanbersamatimkhususpadaSelasa.KetikaitukeadaanPutriterlihatbaik-baiksajanamunpengacaramenyebutnyamenangisterusdidalamkamar.Yosefmengakumelihatadabeberapaorangyaknipengacara,polisiwanita(polwan),danBareskrimikutdalamprosespenggeledahanselamasembilanjam.BacaJuga:BenarkahPutriCandrawathiMengalamiPelecehanSeksual?IniKataKabareskrimAdajugakeduaanakFerdySambodanPutriyakniseoranganakperempuandananaklelakinyapalingkecilberumur1,5tahunbersamapengasuhnyajugaberadadidalamrumah.KeluargaFerdySambotinggaldirumahtersebutkuranglebihsetahunsehinggabelumterlalumengenalkawasanJalanSaguling.ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,KabupatenBekasi,JawaBarat,yangmerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.ANTARA/HO-PolresSerangjpnn.com,SERANG-ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,Bekasi,JawaBarat.DiadidugamerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.PelakuperampokanituberinisialIB(29)wargaBekasi,kataKapolresSerangAKBPYudhaSatriadiSerang,Rabu(10/8).PeristiwaperampokanterjadipadahariSabtu(6/8)pukul22.30WIB.Saatitu,tokobarututupdansejumlahkaryawansudahpulang.BacaJuga:4MalingMotorDiringkusPolisi,PengakuanMerekaMencengangkanPelakuyangmenggunakantopengdangolokitulangsungmenerobosmasuktokolewatpintubelakang.PelakumasukdanlangsungmenodongkangolokkekorbandanmengeluarkanplastikagarkorbanmemasukkanHPdanuang,kataYudha.PemiliktokoNH(41)pasrahmenghadapiancamanperampokyangakanmembacoknya,kemudianmenyerahkanuangRp100jutakedalamkantongplastik.Padasaatitu,pelakumemintakorbanagarmenyerahkanseluruhhandphone.Namunkorbanmenyebutkanbahwaseluruhponselsudahdimasukkankedalambrankas.Pelakuhanyamendapatkanuanglalukeluartokodanmenguncikorbandariluar,kataYudhaSatria.BacaJuga:PerampokBersenpidiApotekMedanAmbrukDiterjangTimahPanas,Bravo,PakPolisiPerampokBersenjatadiApotekDitembakPolisiDalammengungkapkasusitu,polisihanyamembutuhkanwaktuempathari.PolisimenangkapIBditempatkerjanya,Selasa(9/8).Darihasilpenggeledahan,kataYudha,petugasmengamankansejumlahbarangbukti,antaralainsatuunitHondaVario,duacincinemas,duaponsel,sertasejumlahalatuntukmerampok.(antara/jpnn)BeritaSelanjutnya:IdentitasPerampokyangMenewaskanSopirTaksiOnlineSudahDikantongi,Siap-SiapSajaBekRealMadrid,DavidAlaba(jerseiputih)saatmelawanpemainEintrachtFrankfurt(jerseihitam)difinalUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridmenasbihkandirinyasebagaiRajaEropasetelahmempermalukanEintrachtFrankfurtdifinalUEFASuperCup2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Duagolyangmasing-masingdilesatkanolehDavidAlaba(37)danKarimBenzema(65)membawaMadridunggul2-0padalagayangdihelatdiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB.JalannyaPertandinganBacaJuga:PengamatMintaPSMMakassarWaspadaiKualaLumpurCityFC,IniPemicunyaMadridlangsungtancapgassejakmenitawal.JawaraLigaChampionsituterusmencecarpertahananFrankfurtselakukampiunLigaEuropa.Namun,Madridbarubisamembukakeunggulanpadamenit37.UmpandariCasemiromampudituntaskanmenjadigololehAlabasehinggapapanskorberubahmenjadi1-0hinggaturunminum.Dalamkeadaantertinggal,FrankfurtberupayauntukmenekanMadrid.Akantetapi,skortetaptidakberubah.ElRealtetapmemimpin1-0.BacaJuga:BawaIndonesiakeFinalPialaAFFU-162022,BimaSaktiKokMintaMaaf,AdaApa?Padababakkedua,Madridtampakmasihlebihmendominasi.FrankfurtmasihsajakesulitanmenembuspertahanananLosBlancosyangdikawalduetDavidAlabadanEderMilitao.Madridkemudianmenambahkeunggulannyamenit65.AsisstViniciusJuniordisambutdengansepakanmendatarolehKarimBenzemayangtakmampudihalaukiperFrankfurt,KevinTrapp.

KuasahukumkeluargaBrigadirJatauNofryansahYosuaHutabarat,KamaruddinSimanjuntak(kanan)danJohnsonPanjaitandiBareskrimPolribeberapawaktuyanglalu.Foto:Ricardojpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangRabu(10/8)tentangsebuahmisterikepemilikansenjatauntukmembunuhBrigadirJterungkap,satudariempattersangkapembunuhanBrigadirJmuncul,hinggaperintahFerdySamboparah.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahBacaJuga:5BeritaTerpopuler:5PengakuanTerbaruBharadaETerungkap,LPSKMendadakBungkam,KomjenAgusMeresponsTegasMisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:5BeritaTerpopuler:BharadaELegaMembongkarKasusBrigadirJ,AdaRahasiaBesarhinggaUrusanCintaBacaselengkapnya,kliklinkdibawah:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahTersangkaMRsaatdiamankandiPolresRejangLebong.Foto:doklinggauposjpnn.com,REJANGLEBONG-JajaranPolresRejangLebongmembongkarkelakuanasliseorangkhatibmasjidberinisialMR(43)diBengkulu.MRyangselamainidikampungnyadikenalsebagaikhatibmasjidternyatapredatoranak.Korbannyaputrinyasendiri.BacaJuga:DiMasjidMRJadiKhatib,SampaidiRumahBerubahMonster,Biadab!BacaJuga:PerbuatanSopirAngkotIniSungguhBikinEmosiTingkatTinggiPriaparuhbayaituternyatatelahmelakukanhalpalingkejiterhadapanaknyasendiriyangmasihberusia9tahun.WargaRejangLebong,Bengkuluitumemerkosaanaknyasendiri,bahkanitusudahdilakukansejak2019lalu.PerbuatankejiterakhiryangdilakukanMRpadaSelasa(9/8)kemarin.BacaJuga:IstrinyaDigoda,MemedBacokAlpian,TempatPijatBanjirDarahAksibejatnyaitudiketahuitetanggasehinggasampaikemejaPolsekBermaniUlu,RejangLebong.KapolresRejangLebongAKBPTonnyKurniawanmenjelaskantersangkaditangkapberdasarakanlaporankorbandidampingitetangga.

Sejumlahpersoneltampaksedangberbaris.Foto:Ricardo/JPNN.jpnn.com,JAKARTA-KepolisianRepublikIndonesia(Polri)memiliki434.135personelyangtersebardiseluruhwilayahnusantara.Setiappolisimemilikipangkatsesuaidenganseleksipendaftarandanberapalamamerekamengabdidikorpsbajucokelat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SistemkepangkataninisudahdiaturdalamPeraturanKapolriNomor3Tahun2016tentangAdministrasiKepangkatanAnggotaKepolisianRepublikIndonesiadalamBabIItentangGolonganKepangkatanPasal3.AdapunjenjangkepangkatanPolriterbagimenjaditiga,pertamaadatamtama,keduabintara,danketigaperwira.BacaJuga:31AnggotaPolisiMelanggarKodeEtikDalamPenangananKasusKematianBrigadirJ,ApakahAdadariKedokteranForensik?TamtamaDimulaidaripangkatterendahadapadajenjangtamtama.1.BhayangkaraDua(Bharada)Iniadalahpangkatterendahdikepolisianketikaseseoranglulusseleksipendaftarantamtamadansudahmenjalanipendidikan.BacaJuga:IniDaftarNama32PolisiBerprestasiPenerimaKenaikanPangkatLuarBiasadariKapolriBentukpangkatbharadainiadalahgarismiringsatu.2.BhayangkaraSatu(Bharatu)ParapemainRealMadridsaatmerayakangelarUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridsuksesmenggondoltrofiUEFASuper2022setelahmenaklukkanEintrachtFrankfurt.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});BermaindiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB,ElRealunggul2-0atastimJermantersebut.DuagolkemenanganMadridlahirlewataksiDavidAlaba(37)danKarimBenzema(65).BacaJuga:UEFASuperCup2022:PermalukanFrankfurt,RealMadridRajaEropaRaihanpositifinitakterlepasdaripenampilangemilangsejumlahpenggawaElReal.Darisekianbanyaknama,adasetidaknyalimapemainyangpalingmenonjol.Siapasajamereka?Simakulasannyaberikutini.1.CasemiroGelandangasalBrasilinimenjadipemutusseranganFrankfurtsebelummenembuspertahananElReal.Total,Casemiromampumelakukansembilantekelsukses,duaintersep,dansatublok.BacaJuga:BosPSMMintaPerubahanJadwalPertandinganLiga1,IniPenyebabnyaTakcumaitu,CasemirojugaaktifmembantuseranganElRealdengancatatan54umpanakuratdari64percobaan.Takayal,WhoScoredmemberinyanilai8,6,yangtertinggidibandingpemainMadridlainnya.2.KarimBenzemaLagidanlagi,Benzemamembuktikanbahwadirinyabelumhabis.StrikergaekasalPrancisitumenunjukkankualitasnyasebagaifinisherulung.

Kankerotak(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Penyebabkankerotakmasihbelumdiketahuisecarapasti.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Namun,terdapatbeberapafaktoryangdidugamembuatseseoranglebihrentanmengalamikankerotak,diantaranyaadanyamutasigenetik,riwayatkankerotakdalamkeluarga,usiatua,danpaparanradiasi.Makananternyatajugabisamenjadifaktorrisikokankerotak.Karenaitu,kitapatutwaspadaketikaakanmengonsumsimakanantertentu.BacaJuga:BenarkahEsBatuBisaMenyembuhkanAsamUrat?Marikenalijenis-jenismakananpenyebabkankerotakberikutini:1.AlkoholKonsumsialkoholberhubungandengantimbulnyabeberapajeniskanker,sepertikankermulut,kankernasofaring,kankeresofagus,kankerpayudara,hinggakankerotak.Risikokankerakanmeningkatapabiladosisalkoholyangdikonsumsiberlebihan,apalagidisertaikonsumsitembakau.BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?Olehkarenaitu,sebaiknyabatasikonsumsialkohol,bahkanbilaperluhindari.2.MakananyangBerjamurBeberapajenisjamur,salahsatunyaAspergillusflavus,mengandungmetabolitaflatoksin.JamurAspergillusflavusdapatmenjadiparasitpadakacang,pohonkacang,danbiji-bijian.IrjenFerdySamboditahandiMakoBrimob.Foto:Ricardo/JPNN.comjpnn.com,JAKARTASELATAN-Penyidiktimkhusus(timsus)PolrimelakukanpemeriksaanperdanaterhadapIrjenFerdySambosebagaitersangkakasusdugaanpembunuhanBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaanterhadapmantanKadivPropamitudilakukandiMakoBrimob,KelapaDua,Depok,hariini,Kamis(11/8).Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFSsebagaitersangkadiMakoBrimob,kataKadivHumasPolriIrjenDediPrasetyokepadawartawan.BacaJuga:KomnasHAMPeroleh5DataRekamanCCTVsoalPenembakandiRumahFerdySambo,Isinya?Selainitu,kataDedi,penyidiktimkhususjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri,JakartaSelatan.PemeriksaankeduadilakukankepadaKMsebagaitersangkadiBareskrim,ujarDedi.Secaraparalel,Dedimenyebut,pihakInspektoratKhusus(Irsus)PolrijugamenjadwalkanmelakukanpemeriksaanterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJayaterkaitkasuspenembakanBrigadirJ,padahariini.BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaDedimenyebutpemeriksaanitudilakukandiMabesPolri.SedangkanIrsus,agendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJaya,jam10.00WIBdiMabesPolri,ucapDedi.

AudiensipengurusGLPGPPPKdenganSesditjenGTKKemendikbudristekNunukSuryani.Foto:DokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-Pemerintahberencanamenerbitkanpetunjukteknis(juknis)rekrutmenpegawaipemerintahdenganperjanjiankerja(PPPK)awalSeptember.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Namundemikian,gurululuspassinggrade(PG)PPPKjustrupesimistisjadwalpenerbitanjuknisituakanmolorlagi.KetuaForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimengungkapkanKementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)memangsudahmenginformasikanagarmenunggujuknisturun.BacaJuga:PemkabBogorAjukanPenambahanFormasiPPPK2022,PalingBanyakuntukGuruSekretarisDitjenGuruTenagaKependidikan(GTK)NunukSuryanibahkanjugamemintaparagurululusPGagartidakmempercayaidataExcelyangberisidaftarnamadanpenempatankarenasemuanyamenunggujuknis.Meskidemikian,kataIswadi,gurululusPGkhawatirjadwalpenerbitanjuknisitumoloraliastidaktepatwaktu.Jujursaja,kamipesimistisakantepatwaktu,karenamasihharusdirapatkandenganpihak-pihakterkait,terangIswadikepadaJPNN.com,Kamis(11/8).BacaJuga:THPGuruPPPKRp6Juta,PNSRp14Juta,KepalaBKNMerespons,BersyukurlahIswadidanrekan-rekannyamakingusarkarenasaatmerekabertanyakapanseleksiPPPK2022dibuka,tidakadajawabandantimelinejugatakdiberikan.Diamendugahalituterkaitdenganpendataanseluruhtenaganon-aparatursipilnegara(non-ASN)yangsementaraberjalandiseluruhdaerah.PutriCandrawathi(kanan)diMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTA-KalimatyangkeluardarimulutPutriCandrawathikepadatimdariLembagaPerlindunganSaksidanKorban(LPSK),masihmenjaditandatanyabesar.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TimLPSKsebelumnyamelakukanasesmenterhadapistrimantanKadivPropamPolriIrjenFerdySamboitudirumahJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.PutrimerupakansalahsatusaksikuncikasuspembunuhanberencanaterhadapYosuaHutabarataliasBrigadirJyangmelibatkanBharadaE.BacaJuga:IstriIrjenFerdySamboPutriCandrawathiKenapaMalu?EdwinTakTahuKonon,peristiwapembunuhanBrigadirJyangdidugadidalangiIrjenSambo,dipicudugaanpelecehanseksualterhadapPutri.MengacupenjelasanWakilKetuaLPSKEdwinPartogiPasaribu,Putrihanyamengucapkankata-katasingkat.Itupun,adasatukatayangdiulangduakaliolehPutri.BacaJuga:KomjenAgusTegaskanBharadaEMengakukarenaKegigihanPenyidikdanTimsus,BukanPengacaraYangterucaphanyaitu;Malu,Mbak.Malu,ucapEdwinPartogimenirukanmengungkapperkataanPutrikepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).Namun,EdwinmengakutidakpahamdengankatamaluyangdimaksudPutriCandrawathi.Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KepalaDivisiHubunganMasyarakat(KadivHumas)PolriIrjenDediPrasetyomengatakanpemeriksaanterhadapmantanKadivPropamPolriitudilakukandimarkasKomjenAnangRevandoko.Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFS(FerdySambo,red)sebagaitersangkadiMakoBrimob,kataDedidalamketerangannya,Kamis(11/8).BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaJenderalbintangduaitumengatakantimsusjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri.PemeriksaanjugadilakukankepadaKMsebagaitersangkadiBareskrimPolri,kataDedi.Disisilain,InspektoratKhusus(itsus)PolrijugamenjadwalkanpemeriksaanetikterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJaya.BacaJuga:5BeritaTerpopuler:MotifPembunuhanBerencanaBrigadirJTerungkap,1dari4TersangkaMuncul,FerdySamboTernyataPemeriksaandilakukandiMabesPolri.ItsusagendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJayapukul10.00WIBdiMabesPolri,tuturDedi.IstriIrjenFerdySambo,PutriCandrawathi(kanan)saatdidepanMakoBrimobDepok.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenyampaikananalisisperihalkatamaluyangkeluardarimulutPutriCandrawathisaatasesmenolehtimdariLembagaPerlindunganSaksidanKorban(LPSK).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PutrimerupakansalahsatusaksikuncikasuspembunuhanberencanaterhadapBrigadirJyangmelibatkanBharadaEyangdidalangiolehmantanKadivPropamPolriIrjenFerdySambo,suaminyaPutri.Konon,peristiwapembunuhanBrigadirJdipicudugaanpelecehanseksualterhadapPutri.BacaJuga:PutriCandrawathi2KaliBilangMalu,TerkaitMotifPembunuhanBrigadirJ?WakilKetuaLPSKEdwinPartogiPasaribusebelumnyamenyebutPutriCandrawathihanyamengucapkankata-katasingkatsaatasesmen.Yangterucaphanyaitu;Malu,Mbak.Malu,kataEdwinmenirukanucapanPutri.DiapuntidaktahukenapaistriFerdySambobilangmalu.RezaIndragiripunmengungkapanalisisnyasaatdiwawancaraJPNN.com,Kamis(11/8).BacaJuga:IstriFerdySamboMengakuMalu,AnalisisRezaIndragiri:AdaHalBurukSayamalukeluardariorangyangmenganggapdirinyatelahmelakukanbukandiperlakukansesuatuyangburuk,atauketikaorangitumelihatpihaklainmelakukanhalyangburuk,kataReza.LantasadakahkaitankatamaluyangdiucapkanPutriSambodengandugaanMahfudMDbahwamotifpembunuhanBrigadirJmungkinhanyabolehdidengarolehorang-orangdewasa?

HinoDutroZEVyangmejengdiGIIAS2022.Foto:Antarajpnn.com,TANGERANG-PTHinoMotorsSalesIndonesia(HMSI)memamerkansejumlahjajaranproduknyadiajangGaikindoIndonesiaInternationalAutoShow(GIIAS)2022diICEBSD,Tangerang,Kamis(11/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});AdapunprodukyangdibawamulaidaritrukkonvesionalhinggabertengalistrikuntukdikenalkankepadapublikdiIndonesia.Kamimenghadirkanberbagaikendaraanuntukmembantuparapengusahaperkebunan,pertambangan,logistik,hinggatransportasi,kataPresidenDirekturHMSIMasatoUchidasaatkonferensipersdiacaratersebut,Kamis.BacaJuga:TrukHinoTerguling,8TonMinyakGorengTumpahJadiKayakBeginiDiamenambahkantruklistrikyangdiberinamaHinoDutroZEVitumenggunakantipebateraiLithiumIondengankapasitas40kWhuntukpenyalurantenagakemotorlistrik.HinoDutroZEVmenggunakantipenormalchargingACtype1denganwaktu5jamatauquickchargingDCCHAdeMohanyadalamsatujam.Dalamkeadaanbateraipenuhtrukitubisamenempuhjaraklebihdari100kmdanmemilikidayaangkuthinggasatuton.BacaJuga:HinoIndonesiaPastikanSemuaJajaranTrukdanBusSudahStandarEuro4Kemudian,HinojugamemperkenalkaninovasiprodukHino200Seriesyangmemilikitenaga144PS/3.400rpmdenganmesinEuro4dantransmisi5percepatan.Trukitusangattepatuntukbisnispengirimansehari-haridenganjarakpendekdanmenembusjalansempit.InstitutSainsdanTeknologiNasional(ISTN) menawarkanbeasiswabagimahasiswasehinggabisakuliahgratissampaiselesai.FotodokumentasiISTNjpnn.com,JAKARTA-InstitutSainsdanTeknologiNasional(ISTN)membukapendaftaranbeasiswakuliahpenuhempattahundanprogramkeringanan50persen.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});BeasiswaempattahunpenuhmerupakanpengabdianISTNyangsudahberdirisejak1950kepadamasyarakatdalammengimplementasikanPancasilamencerdaskankehidupanbangsa.KepalaLembagaKomunikasiPublikdanPemasaran(LKPP)ISTNTaufikHidayat,ST,MTmengatakanprogrambeasiswaempattahuninimenyediakanuntukprogramstudimatematikadanfisikayangpendaftarannyadilakukansecaraonline.BacaJuga:ISTNMendapatkanDanaHibahPenelitiandariKemendikbudristekPesertayangmengikutiprograminiakanbebasuangkuliahselamaempattahunatausampailulusselamamengikutisyaratdanketentuanyangberlaku.PerkuliahanakandimulaipadaSeptemberyangmanapendaftaranbeasiswainiberlakusampaidenganAgustus2022,kataTaufikHidayatdalamketerangannya,Kamis(11/8).DiamengungkapkanperanISTNsebagailembagapendidikanyangsalahsatutugasnya,yaitupengabdiankepadamasyarakat.BacaJuga:ISTNKembaliMeluluskan421SarjanaTangguhTaufikberharapdariprogrambeasiswainisalahsatunya,yaitubentukpengabdianmasyarakatISTNselakulembagapendidikan,terlebihlagidimasapandemiyangmenyebabkanbanyakorangterkenadampakdaripandemiini.Programkeringanan50persen,lanjutTaufik,merupakanupayaISTNyangmemilikiakreditasiBBAN-PTsebagailembagapendidikandalammendukungprogrampemerintahdalammemberikanbantuanpendidikanterutamadimasapandemi.

AnakbuahIrjenFadilditahanditempatkhususdiMakoBrimobseusaidiperiksaItsusPolribuntutkasustewasnyaBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-InspektoratKhusus(Itsus)PolritelahmemeriksapenyidikPoldaMetroJayayangdidugamelakukanpelanggaranetikbuntutpenanganankasustewasnyaBrigadirNofryansahYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaanterhadapanakbuahIrjenFadilImranberpangkatAKBPitudigelardiBareskrimPolripadahariini,Kamis(11/8)pukul10.00WIB.ItsussudahperiksasatupenyidikPoldaMetroJaya,kataKadivHumasPolriIrjenDediPrasetyodiMakoBrimob,KelapaDua,DepokpadaKamis(11/8)malam.BacaJuga:IrjenDediSebut31PolisiLanggarKodeEtikOlahTKPKematianBrigadirJHasilpemeriksaanitu,Itsusmemutuskanuntukmenahanpenyidiktersebutpadatempatkhusus(Patsus)diMakoBrimob.Kendatidemikian,IrjenDeditakmemerinciidentitaspenyidikberpangkatAKBPitu.Darihasilriksa,langsungditempatkanditempatkhsuusMakoBrimob.Soreini(penyidikyangdiperiksa,red)berpangkatAKBPditaruhdiPatsus,ujarDedi.BacaJuga:BeredarRekamanCCTVMenyangkutPembunuhanBrigadirJ,IrjenDediBilangBeginiDalamkasusini,BharadaEmenembakmatiBrigadirJdiDurenTiga,JakartaSelatanpadaJumat(8/7).BharadaEmenembakmatiBrigadirJatasperintahIrjenFerdySambo.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-EksKadivPropamPolriIrjenFerdySambomengucapkanpermintaanmaafkepadarekansejawatnyadiPolri,keluarga,danmasyarakatyangterdampakdaripolemikdalamkasuspembunuhanNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PermohonanmaafdariIrjenFerdySamboitusepertidisampaikanpengacaranya,ArmanHaniskepadaawakmediadiJakarta,Kamis(11/8).Secaratulusmemintamaafdanmemohonmaaf,kataArmanmembacakansuratpermohonanmaafdariIrjenFerdySambo.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniEksDirekturTindakPidanaUmumBareskrimitusadarpolemikdalamkasustewasnyaBrigadirJbermuaradariperbuatannyayangmemberikaninformasitidakbenar.Memberikaninfomasiyangtidakbenarsertamemicupolemik,ujarnya.IrjenFerdySamboberjanjiakanpatuhdanmengikutisetapproseshukumyangsaatinisedangberjalanataunantidipengadilan.BacaJuga:IrjenFerdySamboMintaMaafkeKapolriHinggaMasyarakat,TetapiTidakMemuatKeluargaBrigadirJAkansayapertanggungjawabkan,ungkapalumnusAkpol1994itu.IrjenFerdySambodalamsuratnyakemudianmengakuhanyaberupayamenjagadanmelindungimuruahkeluargasehinggadirinyaterlibatdalamkasustewasnyaBrigadirJ.

PakarpsikologiforensikRezaIndragiripunyaanalisistentangkatamaluyangdiucapkanistriFerdySambo.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielpunyaanalisismenariktentangkatamaluyangkeluardarimulutPutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KataitusebelumnyadisampaikanistriFerdySambotersebutketikaberhadapandengantimasesmendariLembagaPerlindunganSaksidanKorban(LPSK).DemiAllah.Saatmenontonlive-nyawaktu(Putri)munculdidepanMakoBrimob,sayamembatin,inimenahansedihataumenahanmalu?jawabRezasaatberbincangdenganJPNN.com,Kamis(11/8).BacaJuga:PutriCandrawathi2KaliBilangMalu,TerkaitMotifPembunuhanBrigadirJ?RezaIndragirilantasmenyampaikananalisisbahwaperasaanmalubisadipilahkedalamduaragam.Pertama,malusebagaiperasaantidaknyamanyangmunculketikasisidiriatauperbuatanseseorangtereksposkepihaklaindanitumerusakcitrayanginginorangtersebutbangun.Sisidiriatauperbuatanitubersifatumumbelaka.Misalnya,ngupil,ucappenyandanggelarMCrim(Forpsych-masterpsikologiforensik)dariUniversitasofMelbourneAustraliaitu.BacaJuga:PolisiPerluUsutKeterlibatanFahmiAlamsyah,BisaDijeratPasalPermufakatanJahatMenurutdia,ngupilpadadasarnyabagus,yaknibentukpedulipadakesehatandengancaramengorekhidungagarbersihdarikotoran.namun,ketikaaktivitasituternyatadilihatpihaklain,malahmunculsensasisayamelakukankegiatanyangkotor.Ngupilnyasebetulnyabagus,tetapimenjadijelekkarenadilihatolehpihaklain.Iniadalahembarrasement.Diindonesiakansepadandenganmalu,terangnya.PengacaraHotmanParis.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-DuniaentertainmentJPNNsepanjangJumat(11/8)diramaikandenganpernyataanHotmanParisHutapeasoalkasusBrigadirJ.PengacaranyentrikinimenyorotilaporanistriFerdySambo,PutriCandrawathisoaldugaanpelecehanseksual.HotmanlantasmemberisindiranpedasuntukPutriCandrawathi,terkaitkasusdugaanpelecehandankematianBrigadirJ.BacaJuga:HotmanParisSebutIstriIrjenFerdySambosudahMenangisdariMagelang,AdaApa?Selainitu,penyukaberliandanmobilmewahinimakinpenasarandenganmotifBharadaEyangmenembakmendiangBrigadirJ.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.KasusDugaanPelecehanHotmanmengakupenasaranlantaranistriIrjenFerdySamboitumasihngototmelanjutkankasustersebut.BacaJuga:HotmanParisAkanTerusMemburuRazmandanTeman-temannya,Siap-Siap!Kan,yangdidugapelakualmarhum,kan,sudahmeninggalberartikasusselesai,kataHotmanparis.Bacaselengkapnya:IstriFerdySamboNgototLanjutkanKasusDugaanPelecehan,HotmanParisBilangBegini

WingerTimnasIndonesiaEgyMaulanaVikrisaatberlatihbersamaFKSenica.Foto:Twitter/Egymv1jpnn.com,ZLATEMORAVCE-AdasejumlahalasanyangmembuatFCViONZlateMoravcetertarikmemboyongEgyMaulanaVikri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Melansirtransfermarkt,klubasalSlovakiaitumengikatEgydengankontrakberdurasisatutahun.ManajerZlateMoravce,MarekOndrejkaengganmenyebutkehadiranEgyhanyabagiandaristrategipemasaran.BacaJuga:EgyMaulanaDikontrak1Tahun,WitanLebihLama,BeginiHarapanSangAgenBukanrahasiaumumapabilapemainasalIndonesiadatang,klubakankebanjiraneksposure.Namun,Ondrejkamembantahitudanmenyebuttimnyabenar-benarmembutuhkansosokEgydiataslapangan.KamimengagumikreativitasdanvariasiseranganyangdimilikiEgy.Diajugamemilikikemampuanbagussaatduelsatulawansatu.BacaJuga:EfekEgyMaulanaVikri,PengikutFCViOnZlateMoravceLampauiPopulasiKotanyaDiahadiruntuksepakbola,pemasaranhanyabagiandaribonus,ujarOndrejkadilansirdarilamanresmiklub.Kendatidemikian,Ondrejkatakmembantahpemasaranyangbagusakanmemberikanefekpositifbagiklub.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-EksKadivPropamPolriIrjenFerdySambomengutarakanmotivasidanniatnyadibalikkasuspembunuhanNofriansyahYoshuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});ApayangdilakukanFerdyitu,semata-matahanyainginmenjagadanmelindungimuruahkeluarga.PengakuanFerdyitutertuangdalamsuratpernyataanyangdibacakanpengacaranya,ArmanHaniskepadaawakmediadiJakarta,Kamis(11/8).BacaJuga:IrjenFerdySamboBikinSurat,DibacakanPengacaranya,SinggungSoalNiatNiatsayauntukmenjagadanmelindungimaruahsertakehormatankeluargayangsangatsayacintai,ujardia.Terlepasdariitu,alumnusAkpol1994itumenyampaikanpermintaanmaafkepadarekansejawatnyadiPolri,keluarga,danmasyarakatyangterdampakdaripolemikdalamkasuspembunuhanBrigadirJ.Secaratulusmemintamaafdanmemohonmaaf,kataArman.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniEksDirekturTindakPidanaUmumBareskrimitusadarpolemikdalamkasustewasnyaBrigadirJbermuaradariperbuatannyayangmemberikaninformasitidakbenar.Memberikaninfomasiyangtidakbenarsertamemicupolemik,ujarnya.MantanKadivPropamPolriIrjenFerdySambotersangkakasuspembunuhanberencanaterhadapBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MotifpembunuhanterhadapBrigadirNofryansahYosuaHutabarataliasBrigadirJakhirnyaterkuak.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidamaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutmotifpembunuhanitukarenaIrjenFerdySambomerasaemosidanmarahkepadaBrigadirJ.Sebab,PutriCandrawathidilukaiharkatdanmartabatnyaolehBrigadirJ.BacaJuga:IrjenFerdySamboBikinSurat,DibacakanPengacaranya,SinggungSoalNiatFaktaituterungkapsetelahtimkhusus(timsus)memeriksaIrjenFerdySambosebagaitersangkadiMakoBrimob,KelapaDua,Depok,Kamis(11/8).DalamketerangannyatersangkaFS(FerdySambo,red)mengatakanbahwadirinyamenjadimarahdanemosisetelahmendapatlaporandariistrinyaPC(PutriCandrawathi,red)yangtelahmengalamitindakanyangmelukaiharkatdanmartabatkeluarga,kataBrigjenAndidiMakoBrimobKelapaDua,Kamis(11/8).TindakanyangdilakukanBrigadirJterhadapPutriCandrawathiituterjadidiMagelang.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniJenderalbintangsatuitumengatakanmengatakanketeranganFerdySambotersebuttelahdituangkandalamberitaacarapemeriksaan(BAP).ItupengakuantersangkadiBAP,ujaralumnusAkpol1991itu.PengacaraRazmanArifNasution.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraRazmanArifNasutionmenyindirHotmanParismelaluiakunnyadiInstagram.HalitusehubungandenganHotmanParisyangmemprediksikasuskematianBrigadirJsertamemberikanmasukanuntukBharadaE.RazmanNasutionlantasmenyindirapakahrivalnyaitusudahbergantiprofesilantaranmembuatprediksisepertiitu.BacaJuga:WendiCagurBanjirPujianGegaraRokAyuTingTingSobekIniorangsudahjadiperamalya?Atausudahmerangkapperamaldanpengacara?ujarRazmandikutipKamis(11/8).DiajustrumemintapengacaraBharadaEagarberhati-hatidenganucapanHotmanParis.SebabdiamendugaHotmanmemilikiniatlaindibaliksikapnyatersebut.BacaJuga:SorotiWajahHotmanParis,RazmanNasution:KeracunanObatAtauBisajadiiniupayadiauntukmencarisimpatipihakkeluargaBharadaEseolah-olahHotmanParisyangpalingpahamakanupayapembelaanhukumterhadapBharadaE,kataRazmanNasution.Sebelumnya,HotmanParisternyatasempatmemprediksisoaladanyatersangkabarudalamkasuskematianBrigadirJ.

DahlanIskan(Disway).Foto:Ricardo/JPNN.comjpnn.com-MEDIAinilahyangharusdicatatsebagaipembukaperistiwaDurenTiga.Mediamainstream.Kalautidak,bisajadiperistiwaituterkuburmungkinuntukselama-lamanya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});MediaituadadiJambi.Wartawanitusebenarnyatelattahu:adapolisi,asalJambi,yangmatitertembak.Sudahduaharisebelumnya.Wajartelat.Rumahpolisiitudipedalaman.Sangkorbanjugadikuburdipedalamanitu.Kurangbisamenarikperhatianseketika.BacaJuga:KepungCendolSiwartawanlantaskePoldaJambi.HumasPoldatidaktahu.IamemintaSiwartawankeKabidPropam.MungkinbidangPropamyangtahu.InikanmenyangkutanggotaPolri.Namun,PropamPoldaJambijugatidaktahu.Tidakbisamenjawab.MakaPropamJambimenanyakanitukePropamMabesPolri.FerdySambopunambilkesimpulan:berartiperistiwaDurenTigasudahdiketahuimedia.Tidakbisalagiditutupi.Harusdisiapkanjawabanyangtepat.Yangbisamembantumenyusunjawabanituharusorangyangmemahamimedia.BacaJuga:LabirinPolkamIrjenFerdySambotidaksulitmencariorangyangpunyakualifikasidekatdenganmedia.Iajugasosokyangaman.Tepercaya.IapenasihatahliKapolri,bidangkomunikasipublik.MakaJenderalSambomeneleponSangpenasihatmedia:FahmiAlamsyah.SejumlahpersonelBrimobbersenjatalengkapsaatberjagadirumahpribadiIrjenFerdySambo,JalanSagulingIII,KomplekPertambangan,DurenTiga,JakartaSelatan,Selasa(9/8/2022).Foto/dok:Ricardo/JPNNjpnn.com,JAKARTA-DahlanIskanmengungkapsosokyangdihubungiIrjenFerdySambosetelahkematianYosuaHutabarataliasBrigadirJdiketahuiwartawanmediamainstream.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});CeritayangdiperolehkolumniskondangitudituangkandalamtulisanDiswayedisiJumat(12/8).DalamtulisanituDahlanmenjelaskanawalkematianBrigadirJterungkapkepubliksetelahterciumolehwartawanmediamainstreamdiJambi.BacaJuga:InikahSebabMediaTelatTahusoalInsidendiRumahFerdySambo?Kalautidak,bisajadiperistiwaituterkuburmungkinuntukselama-lamanya,tulisDahlandalamtulisanberjudulBintangWanita.Konon,wartawanyangmengetahuikematianBrigadirJmengonfirmasinyakepadahumasPoldaJambi.Namun,karenapolisididaerahitutidakmengetahuikejadiannya,pihakPoldaJambipunbertanyakeMabesPolri.BacaJuga:UcapanMaluPutriSambodanKonten17TahunkeAtas,HmmmSingkatcerita,FerdySambomengambilkesimpulan:berartiperistiwaDurenTigasudahdiketahuimedia.Tidakbisalagiditutupi,sambungtulisanDahlan.

SkuadVietnamU-16saatberlagadiPialaAFFU-162022.Foto:Twitter/AFFPressejpnn.com,YOGYAKARTA-PelatihVietnamNguyenQuocTuanungkapketakutantersebarnyasaatjumpaTimnasU-16IndonesiadifinalPialaAFFU-162022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Nguyensedikitkhawatirdenganterorsuportertuanrumah.Bukantanpaalasan,sangjurutaktikmenjadisaksisaatkipercadanganVietnamdilemparibotololehsuporter.BacaJuga:FinalPialaAFFU-162022:VietnamDiterpaKabarBurukJelangJumpaIndonesiaDukungansuporter(diIndonesia,red)terkadangterlaluliar.Ituyangmembuatkamikesulitan,ucapNguyen.Kendatidemikian,Nguyenmengakutimnyasudahsiapdengansegalatekanandanterordarisuporter.Sayasudahsiapkanmentalpemainagarmerekapercayadiri,imbuhdia.BacaJuga:BukanTrikPemasaran,TernyataIniAlasanFCViONZlateMoravceBoyongEgyMaulanaBimaSaktidisisilain,memintasuportermemberikandukungankepadaTimnasU-16Indonesiasecaradewasa.Dukungkamisecarafairdansportif.Kitaharusrespekdengansemualawan,ucapBima.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-BareskrimPolrimenyebutBhayangkaraDuaRichardEliezeratauBharadaEtelahmencabutsuratkuasaterhadapkeduakuasahukumnya,DeolipaYumaradanBurhanuddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianmengatakanpencabutankuasatersebutdilakukanBharadaEpadaRabu(10/8).Pengacarabukanmengundurkandiri,tetapikuasasipengacaradicabutolehsipemberikuasa,kataAndisaatdikonfirmasi,Jumat(12/8).BacaJuga:IniSosokKM,1dari4TersangkaKasusPembunuhanBerencanaBrigadirJ,TernyataJenderalbintangsatuitumengatakanDeolipadanBurhanuddinmerupakansenjatinyapengacarayangditunjukpenyidikgunamendampingisaatpemeriksaan.MerekapengacaraditunjukolehpenyidikuntukmendampingiBharadaREdalampemeriksaanpasca-pengacaraawalyangditunjukolehtersangkaFSuntukBharadaREmengundurkandiri,ujarAndi.BrigjenAndimenyebutBharadaEtelahmenunjukpengacaralainsebagaipenggantiDeolipadkk.BacaJuga:FerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretKendatidemikian,Andibelummemerincisiapapenggantinya.Sebelumnya,beredarsuratyangmenyebutkanBharadaEmencabutkuasanyaterhadapDeolipadanBurhanuddin.

IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-IrjenFerdySambomenulissebuahsuratdariMakoBrimob.IsisurattersebutdibacakanpengacaramantanKepalaDivisiProfesidanPengamanan(KadivPropam)Polri.FerdySambomengakupolemikkasuskematianajudannya,BrigadirJitubermuaradariperbuatannyayangmemberikaninformasitidakbenar.BacaJuga:MengapaFerdySamboHubungiSosokIniSetelahKematianYosuaTakBisaDitutupi?Memberikaninfomasiyangtidakbenarsertamemicupolemik,katapengacaraFerdySambo,ArmanHanis.FerdySambomemintamaafkepadaseluruhpihakyangterdampakpolemikkasuspembunuhanBrigadirJ.Namundemikian,IrjenFerdySambomenunjukkansikapkesatriadenganberjanjiakanpatuhdanmengikutisetiapproseshukumyangsaatinisedangberjalanataunantidipengadilan.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanAkansayapertanggungjawabkan,ungkapalumnusAkpol1994itu.Selainitu,dikatakanArmanHanis,eksDirekturTindakPidanaUmumBareskrimitumenyampaikanpermintaanmaaf.KetuaKomnasHAMRIAhmadTaufanDamanik.Foto:Ricardojpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)telahmemeriksamantanKadivPropamIrjenFerdySambodiMakoBrimob,Depok,Jumat(12/8)sore.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaantersebutdalamkapasitasSambosebagaitersangkakasuspenembakanyangmenewaskanBrigadirYosuaHutabaratatauJ.KetuaKomnasHAMAhmadTaufanDamanikmengatakanpemeriksaantersebutdilakukandalamsaturuangankhususyangberisidirinya,IrjenSambo,KomisionerKomnasHAMBekaUlungHapsara,danChoirulAnam.BacaJuga:IrjenFerdySamboMengakuiPalingBertanggungJawabatasKematianBrigadirJMenurutTaufan,dalampermintaanketeranganataupemeriksaantersebut,adabeberapahalyangdiperoleh.PertamaadalahpengakuansaudaraFSbahwadiaaktorutamadariperistiwaini.FSmengakuisejakawaldialahyangmelakukanlangkah-langkahuntukmerekayasa,mengubah,ataumendisinformasibeberapahal,ucapTaufan.AkibatrekayasaIrjenSambotersebut,skenarioawalnyaterbanguninsidentembakmenembakyangmelibatkanBrigadirJdanBharadaE.BacaJuga:WahaiKapolri,IniSikapPakJokowisoalMisteriMotifPembunuhanBrigadirJNamunkemudiandiakuinyaituhasilrancanganFSsendiridanmengakuibahwadiabersalahdalamtindakannya,ucapDamanikPatiYanmaitupunmenyampaikanpermintaanmaafkepadasemuapihaktermasukKomnasHAMdanmasyarakatIndonesiaatastindakannya.

Tags

Artikel Terkait

rans88

岳夏

rans88

HFIZn0Y

2022-08-13 11:19
2890 min read
vip slot 99

侯高俊杰

vip slot 99

z2X3apc

2022-08-13 10:19
919 min read
istana777 slot link alternatif

小斯韵

istana777 slot link alternatif

Qi64zNa

2022-08-13 10:11
2622 min read

Terpopuler Bulan Ini

01

qq penghasil uang

吴炜

2022-08-13 11:23
2863 min read
02

big777 alternatif

安康

2022-08-13 10:49
1325 min read
03

togel mainan

埃利克克莱普顿

2022-08-13 09:19
379 min read
04

agen pkv mudah menang

曲祐良

2022-08-13 08:47
310 min read
05

pasar bola 365

降央卓玛

2022-08-13 08:42
438 min read